PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca54893.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family NAC
Protein Properties Length: 361aa    MW: 41021.2 Da    PI: 7.2514
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca54893.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM172.99.7e-54161451129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                 +ppGfrFhPtdeel+++yLkkkv+ +k+++ +vi+evd++k+ePwdL++++k     ++ewyfFs++d+ky+tg+r+nrat++g+Wkatg+dk + + +
  Dca54893.1  16 VPPGFRFHPTDEELLHYYLKKKVSYQKFDM-DVIREVDLNKMEPWDLQERCKIgstPQNEWYFFSHKDRKYPTGSRTNRATNAGFWKATGRDKCIRN-T 112
                 69****************************.9***************964444222455*************************************9.8 PP

         NAM  97 gelvglkktLvfykgrapkgektdWvmheyrle 129
                  +++g++ktLvfy+grap+g+ktdW+mheyrle
  Dca54893.1 113 FKKIGMRKTLVFYRGRAPHGQKTDWIMHEYRLE 145
                 899****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-6114167IPR003441NAC domain
PROSITE profilePS5100557.78416167IPR003441NAC domain
PfamPF023654.2E-2817144IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0048829Biological Processroot cap development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MGSSSNNNNS NSNGGVPPGF RFHPTDEELL HYYLKKKVSY QKFDMDVIRE VDLNKMEPWD  60
LQERCKIGST PQNEWYFFSH KDRKYPTGSR TNRATNAGFW KATGRDKCIR NTFKKIGMRK  120
TLVFYRGRAP HGQKTDWIMH EYRLEDGDDP NGATCEDGWV VCRVFKKKNL FKVGGEQQNV  180
GGGGGATTSS NTSDQLLIHG SSSNNNNTQS RAFIPRDQYG HHHQHQQHHL LLRSDQATSP  240
FDLYMSKPTD LGLHNNYAHP HQITPLPDYA TVAHPNQLYN SVGEAGPTLE MAACEPSDPH  300
HHHHQGINEW TMLDRAVVGG QDDEQGNGND LSTTVHDMTQ QQQQQQQLSL RGEMDFWGYA  360
K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B4e-541616917167NAC domain-containing protein 19
4dul_A4e-541616917167NAC domain-containing protein 19
1ut7_B4e-541616917167NO APICAL MERISTEM PROTEIN
1ut7_A4e-541616917167NO APICAL MERISTEM PROTEIN
1ut4_B4e-541616917167NO APICAL MERISTEM PROTEIN
1ut4_A4e-541616917167NO APICAL MERISTEM PROTEIN
3swp_D5e-541616920170NAC domain-containing protein 19
3swp_C5e-541616920170NAC domain-containing protein 19
3swp_B5e-541616920170NAC domain-containing protein 19
3swp_A5e-541616920170NAC domain-containing protein 19
3swm_D5e-541616920170NAC domain-containing protein 19
3swm_C5e-541616920170NAC domain-containing protein 19
3swm_B5e-541616920170NAC domain-containing protein 19
3swm_A5e-541616920170NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00431DAPTransfer from AT4G10350Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010688726.11e-175PREDICTED: protein BEARSKIN1
SwissprotQ9SV871e-134BRN2_ARATH; Protein BEARSKIN2
TrEMBLA0A0J8BMR91e-175A0A0J8BMR9_BETVU; Uncharacterized protein
STRINGBra000709.1-P1e-135(Brassica rapa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G10350.11e-123NAC domain containing protein 70